Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDGGAATNASGVAAAAAAAAGNGVQAGAAGERAEDASKQNLAQVTASIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAEFDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEAYREIRATSAAESKRLAQSQSTLPNGDVKVKPEH |
Length | 191 |
Position | Middle |
Organism | Oryza punctata (Red rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.318 |
Instability index | 28.48 |
Isoelectric point | 5.26 |
Molecular weight | 20199.40 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03779 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.64| 14| 16| 52| 65| 1 --------------------------------------------------------------------------- 52- 65 (24.66/16.08) LGLLHQLNLNVSSF 71- 84 (23.98/15.48) LPLLQRLNALVAEF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DVKVKPEH 2) KRLAQS 3) LRKHLL 4) TNASGVAAAAAAAA 5) VEAYREIRAT | 184 171 140 7 156 | 191 176 145 20 165 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab