<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03767
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAAANPNPDDPAQPQPGAAAAAAGAPAAQAQAPPAQAPPALDLAEHPKAMSHALVLAAKKFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHCINLKKPDWATVRSQQHMTI |
| Length | 182 |
| Position | Middle |
| Organism | Oryza punctata (Red rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.350 |
| Instability index | 50.04 |
| Isoelectric point | 4.68 |
| Molecular weight | 19431.72 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03767
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.95| 35| 128| 5| 40| 1
---------------------------------------------------------------------------
5- 40 (56.31/36.13) SQLQEQLnEMAMVAVNTFGTLQRDAPPVRLSNNYPD
136- 170 (57.64/32.78) SELQKQL.EAAELELKQVEALFNEATDHCINLKKPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.17| 16| 16| 45| 60| 2
---------------------------------------------------------------------------
45- 60 (32.34/15.26) AAAANPNPDDPAQPQP
63- 78 (28.83/12.76) AAAAAGAPAAQAQAPP
---------------------------------------------------------------------------
|