<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03715

Description Uncharacterized protein
SequenceMDRVRGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSKDISKDNRALGKLRREAERAKRALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLEKSQIHEIVLVGGSTRIPKVQQLLRDYFEGKEPNKGVNPDEAVAYGAAVQGSILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEEKLKEVEAVCNPIISAVYQRTGGAPGGGADGEGGVDDEHDEL
Length665
PositionUnknown
OrganismOryza punctata (Red rice)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza.
Aromaticity0.06
Grand average of hydropathy-0.476
Instability index25.22
Isoelectric point5.09
Molecular weight73415.27
Publications

Function

Annotated function
GO - Cellular Component
endoplasmic reticulum lumen	GO:0005788	IEA:EnsemblPlants
plant-type vacuole membrane	GO:0009705	IEA:EnsemblPlants
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
GO - Biological Process
protein folding in endoplasmic reticulum	GO:0034975	IEA:EnsemblPlants

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP03715
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.20|      26|      27|     578|     603|       1
---------------------------------------------------------------------------
  578-  603 (42.31/24.84)	MKNTVG..DKDKLADKLESEEKEKVEEA
  604-  631 (36.89/20.74)	LKEALEwlDENQTAEKEEYEEKLKEVEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.30|      11|      27|     229|     239|       2
---------------------------------------------------------------------------
  229-  239 (20.46/12.33)	LGGGTFDVSIL
  257-  267 (21.85/13.71)	LGGEDFDQRIM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.55|      16|      16|     183|     198|       3
---------------------------------------------------------------------------
  183-  198 (26.64/15.98)	AQRQATKDAGVIA.GLN
  200-  216 (20.92/11.15)	ARIINEPTAAAIAyGLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.64|      19|      22|      61|      81|       4
---------------------------------------------------------------------------
   61-   81 (27.11/23.27)	DQGNrITPSWVAFtDSERLIG
   86-  104 (33.54/18.86)	NQAA.VNPERTIF.DVKRLIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.71|      13|     266|     107|     127|       5
---------------------------------------------------------------------------
  107-  127 (18.77/30.18)	FEDKEvqrdmklvPYKIVNKD
  383-  395 (26.94/17.78)	FEGKE........PNKGVNPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.22|      34|     193|     280|     314|       7
---------------------------------------------------------------------------
  280-  314 (51.24/36.23)	KDISKDNRALGKLRREA.ERAKRAlSNQHQVRVEIE
  476-  510 (56.98/36.09)	RSMTKDCRLLGKFDLSGiPPAPRG.TPQIEVTFEVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.84|      20|     242|     401|     421|       9
---------------------------------------------------------------------------
  401-  421 (31.67/17.35)	GAAVQGSIlSGEGG.DETKDIL
  645-  665 (35.17/15.83)	GGAPGGGA.DGEGGvDDEHDEL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP03715 with Med37 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) KDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEEK
585
625

Molecular Recognition Features

MoRF SequenceStartStop
NANANA