<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03710
| Description |
Uncharacterized protein |
| Sequence | MKWASHRILSRRSPETKGTLSTCAAAAAAAATMSKAGGSSGAAAGPTAAAAAAAVQKQKTLLQKSDADVSSLVDNFAALINIARVNDPPVRNTQEAFQMDMRGSRMVHSADSLLKLVSELKRTAIFSGLASLTENVDRRIEVLSQQAEGTERMLERIGQEAAGSLKELEAHYYSSVVRTPLDE |
| Length | 183 |
| Position | Head |
| Organism | Oryza punctata (Red rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.220 |
| Instability index | 44.73 |
| Isoelectric point | 8.79 |
| Molecular weight | 19400.74 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03710
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.12| 18| 21| 18| 35| 1
---------------------------------------------------------------------------
18- 35 (32.41/16.71) GTLSTCAA...AAAAAATMSK
37- 57 (25.71/11.98) GGSSGAAAgptAAAAAAAVQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.24| 16| 16| 125| 140| 2
---------------------------------------------------------------------------
125- 140 (26.39/17.71) IFSGLASLTENVDRRI
142- 157 (24.86/16.34) VLSQQAEGTERMLERI
---------------------------------------------------------------------------
|