<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03709
Description |
Uncharacterized protein |
Sequence | MKWASHRILSRRSPETKGTLSTCAAAAAAAATMSKAGGSSGAAAGPTAAAAAAAVQKQKTLLQKSDADVSSLVDNFAALINIARVNDPPVRNTQEAFQMDMRGSRMVHSADSLLKLVSELKRTAIFSGLASLTENVDRRIEVLSQQAEGTERMLERIGQEAAGSLKELEAHYYSSVAF |
Length | 178 |
Position | Head |
Organism | Oryza punctata (Red rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.167 |
Instability index | 45.70 |
Isoelectric point | 9.16 |
Molecular weight | 18808.10 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03709
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.12| 18| 21| 18| 35| 1
---------------------------------------------------------------------------
18- 35 (32.41/17.37) GTLSTCAA...AAAAAATMSK
37- 57 (25.71/12.48) GGSSGAAAgptAAAAAAAVQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.24| 16| 16| 125| 140| 2
---------------------------------------------------------------------------
125- 140 (26.39/20.17) IFSGLASLTENVDRRI
142- 157 (24.86/18.61) VLSQQAEGTERMLERI
---------------------------------------------------------------------------
|