<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03698

Description Uncharacterized protein
SequenceMEEVQHPLHDHQQWMGLMQPQSQHNQQHQSQQHIMAAFQSQSNQLQQELGMEQKPSVPQSFQTSAGKFLQQNNIDEQMQYTQAQCGLQEVPFSTTMHIITQTDHPGQCYLQDEIYDMVRNLKDQHFTELYHLYNKISRKQEYVDSQMPSQMPIEQYGKMKKFKEMLERILRFLQINKGDILPALAEKIPKYERQIITLVEKPSFVGRAISTIVPVTIKT
Length219
PositionTail
OrganismOryza nivara (Indian wild rice) (Oryza sativa f. spontanea)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza.
Aromaticity0.08
Grand average of hydropathy-0.744
Instability index75.29
Isoelectric point6.35
Molecular weight25716.05
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03698
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.28|      17|      17|      10|      26|       1
---------------------------------------------------------------------------
    9-   25 (36.23/17.30)	HDHQQWMGLMQP.QSQHN
   26-   43 (27.05/11.31)	QQHQSQQHIMAAfQSQSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.49|      20|      21|      69|      89|       2
---------------------------------------------------------------------------
   69-   89 (31.73/19.04)	LQQNNIDEQMQYtQAQCGLQE
   93-  112 (37.76/19.00)	STTMHIITQTDH.PGQCYLQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.41|      12|      20|     133|     144|       4
---------------------------------------------------------------------------
  133-  144 (20.50/10.38)	YNKISRKQEYVD
  156-  167 (20.91/10.68)	YGKMKKFKEMLE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03698 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MEEVQHPLHDHQQWMGLMQPQSQHNQQHQSQQHIMAAFQSQSNQLQQELGMEQKPSVPQSFQTSAGKF
1
68










Molecular Recognition Features






MoRF SequenceStartStop




NANANA