<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03698
| Description |
Uncharacterized protein |
| Sequence | MEEVQHPLHDHQQWMGLMQPQSQHNQQHQSQQHIMAAFQSQSNQLQQELGMEQKPSVPQSFQTSAGKFLQQNNIDEQMQYTQAQCGLQEVPFSTTMHIITQTDHPGQCYLQDEIYDMVRNLKDQHFTELYHLYNKISRKQEYVDSQMPSQMPIEQYGKMKKFKEMLERILRFLQINKGDILPALAEKIPKYERQIITLVEKPSFVGRAISTIVPVTIKT |
| Length | 219 |
| Position | Tail |
| Organism | Oryza nivara (Indian wild rice) (Oryza sativa f. spontanea) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.744 |
| Instability index | 75.29 |
| Isoelectric point | 6.35 |
| Molecular weight | 25716.05 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03698
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.28| 17| 17| 10| 26| 1
---------------------------------------------------------------------------
9- 25 (36.23/17.30) HDHQQWMGLMQP.QSQHN
26- 43 (27.05/11.31) QQHQSQQHIMAAfQSQSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.49| 20| 21| 69| 89| 2
---------------------------------------------------------------------------
69- 89 (31.73/19.04) LQQNNIDEQMQYtQAQCGLQE
93- 112 (37.76/19.00) STTMHIITQTDH.PGQCYLQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.41| 12| 20| 133| 144| 4
---------------------------------------------------------------------------
133- 144 (20.50/10.38) YNKISRKQEYVD
156- 167 (20.91/10.68) YGKMKKFKEMLE
---------------------------------------------------------------------------
|