<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03678
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDGGAATNASGVAAAAAAAGNGVQAGGGGERAEDASKQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEAYREIRATAAAESKQLAQSQSALPNGDVKVKPEH |
| Length | 190 |
| Position | Middle |
| Organism | Oryza nivara (Indian wild rice) (Oryza sativa f. spontanea) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.329 |
| Instability index | 31.64 |
| Isoelectric point | 5.23 |
| Molecular weight | 20107.35 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03678
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.59| 13| 16| 46| 58| 1
---------------------------------------------------------------------------
46- 58 (22.61/17.01) SIQRTLGLLHQLN
65- 77 (21.98/16.35) SSASQLPLLQRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.21| 14| 16| 4| 17| 2
---------------------------------------------------------------------------
4- 17 (21.31/10.96) GAATNASGVAAAAA
22- 35 (23.89/13.03) GVQAGGGGERAEDA
---------------------------------------------------------------------------
|