<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03668

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAGELGQQTVELGAVVRRAAEDSYLALRELVEKSRVEAEGKNGQQRSDTEKKIDLLKFIDRTRQRMLRLHVLAKWCQQVPLVHYCQQLASTLSSHETCFTQTADSLFFMHEGLQQARAPIFDVPSAIEVLHTGSYRRVPKCVEEIGTQNTLFQDEQKPTLKKLSTLVRAKLLEISLPKEISEVSVTDGIANVQVDGEFKVLITLGYRGHFSLWRILHMELLVGEKAGPIKLEETRRYALGDDIERRMAVADNPFMILYTILHELCISLVMDTVIRQTNVLRQGRWKDAIKSELISDIGTGQGGSNAVMQLGQDGELDSSGSRIPGLKINYWLEEKNNASAESDSSPYIKIEAGQDMQIKCQHSSFVLDPFTDKEADLSIDLSCIDVEALILKAIACNRHTRLLEIQRELMKNVQMSQSSTEVILKREVHGEGFQKRVHRRDSNDCCTNEMLQVRAYGQSYIDLGINIRNGRFLLQSLGNILPPSAVLDSEEALNKGSTTATDVFVSLRTRSILHLFAATGSSLGLKVYSQSQVTLKIPKSILCGSEFMVMGFPQCANAYYLLMQLDKSFKPVFCLLEIQSNEGDNNNADATTDAKEAIRFIRIDISKLKIDEDVQIGNFFDKDKLLALQNVEDRPQRQSGADEPLPARPSFFSIVDEVFRCDRGSPITESQRLPPNSLPSSHSSYQVGLHGFSGGAGSPDQDYGSLQSNINAAKVTSGTGLNNYLLSNSKNAQSTSAFSGSVPAGLGNVSSSRSEGAYKKRSLSEFLQNIPSSKQSIIGDGPGKRRKLSEFMLDGLPLKANSPNMQPRTSLTYGKLLEEVNNCITANIYSSVLLHVIKHCSICIKYAQLTAQMDSLNIPHVEEVGMPTSSSNLWLRLPFAHDASWKHICLHLGKAGSMSWDVRINDPHYGALWKLHGGSTTTEWGSGVRVANTSEVDSHISFDDDGVLLTYNTVEADSIQRLVSDLQRLSHARAFSCGMRRLIGVKLDGKLAEHQTAAETKLHSRRKASRDRLSEQMRKTFRIEAVGLMSLWFSYGAVPMVYFVVEWETGKSGCTMRVSPDQLWPHTKFLEDFVNGDEIASFLDCIRLTAGPLLALGGAIRPAKMPVTVPAGYSALPKQNNILTTAGSANSLSSSTVHNMSVPQGAAVAHSNSQLQTSSMLSVAGRTAPGLVPSSLLPFDVSVVLRGPYWIRIIYRNKFSVDMRCFAGDQVWLQPATPPKGGPSVGGSLPCPQFRPFIMEHVAQGLNALEPNLLNARHTGPPLNASANTVSGNQQLASAPNRFGGAPGVARPTSTVANQVASSLSRAGNAMMPSGFASGIAGAPAHLSPGNVPAHMKGELNTAFIGLGDDGGYGGGWVPLAALKKVLRGILKYLGVLWLFAQLPDLLKEILGSVLKDNEGALLNLDHEQPALRFFVGGYVFAVSVHRVQLLLQVLNVKRFHHQQQQQQQTPQNNGQEELTVPEISEICDYFSRRVASEPYDASRVASFITLLTLPISVLREFIKLIAWKKSLPQAHADNATTHRARIEICLEKHPRLVSDDYTASSSSSKSNIHHDRANNSVDFALTFVLDQALVPHMSISGGAAWLPYCVSVRVRYTFGEDSHIAFLAMDGSHSGRACWLQHEDWERCKQRVSRAVETMNGSAAVGDMSQGRLRMVAEMVQKQLQLSLLQLRDSPVSTGSAAS
Length1684
PositionTail
OrganismOryza nivara (Indian wild rice) (Oryza sativa f. spontanea)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza.
Aromaticity0.07
Grand average of hydropathy-0.209
Instability index49.54
Isoelectric point7.87
Molecular weight184967.65
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     162.28|      40|     360|    1196|    1235|       1
---------------------------------------------------------------------------
  652-  684 (30.18/12.07)	...FSiVDevFR.CDRGSPITESQRLPPNSLPSSHSS........
 1196- 1235 (80.53/45.01)	RNKFS.VD..MR.CFAGDQVWLQPATPPKGGPSVGGSLP.CPQFR
 1557- 1594 (51.57/26.06)	RANNS.VD..FAlTFVLDQA.LVPHMSISGGAAW...LPyCVSVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.23|      59|     360|     113|     215|       2
---------------------------------------------------------------------------
  113-  134 (14.58/32.07)	..................................................................................LQQARAPIFDvPSAI....EVLHTGS
  160-  197 (47.68/39.72)	LKKLSTLVRAKLLEI..SLPKEIS.EVSVTDGIANVQVDGE...................................................................
  391-  497 (64.97/25.44)	LKAIACNRHTRLLEIqrELMKNVQmSQSSTEVILKREVHGEgfqkrvhrrdsndcctnemlqvraygqsyidlginirngrfLLQSLGNILP.PSAVldseEALNKGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.32|      15|      18|     701|     717|       3
---------------------------------------------------------------------------
  701-  717 (21.16/17.52)	QDYgsLQSNINAAKVTS
  722-  736 (26.16/14.53)	NNY..LLSNSKNAQSTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.66|      20|      25|     881|     904|       4
---------------------------------------------------------------------------
  881-  904 (31.26/32.28)	H.DASWKhicLHlGKAGSMSW..DVRI
  908-  930 (31.40/17.55)	HyGALWK...LH.GGSTTTEWgsGVRV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.41|      20|      24|    1275|    1297|       5
---------------------------------------------------------------------------
 1275- 1297 (32.16/24.38)	QLASAPNRFGGA..P.GVArptSTVA
 1299- 1321 (27.25/12.54)	QVASSLSRAGNAmmPsGFA...SGIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.41|      20|      24|     748|     771|       6
---------------------------------------------------------------------------
  752-  771 (36.05/26.78)	SR....SEGAYKKRSLSEF.LQNIP
  773-  797 (27.36/ 9.72)	SKqsiiGDGPGKRRKLSEFmLDGLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.80|      37|      59|    1451|    1487|       7
---------------------------------------------------------------------------
 1451- 1487 (65.11/43.35)	PQNNGQEELTVPEISEICDYFSRRVASEPYDASRVAS
 1513- 1549 (64.69/43.02)	PQAHADNATTHRARIEICLEKHPRLVSDDYTASSSSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.13|      19|      24|    1330|    1348|      13
---------------------------------------------------------------------------
 1330- 1348 (35.17/22.88)	GNVP.AHMKGELNTAFIGLG
 1356- 1375 (29.96/18.36)	GWVPlAALKKVLRGILKYLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.34|      14|      18|    1155|    1169|      16
---------------------------------------------------------------------------
 1155- 1169 (20.99/16.52)	LQTSSML....SVAGRtAP
 1171- 1188 (19.35/ 9.55)	LVPSSLLpfdvSVVLR.GP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.63|      15|      18|     809|     823|      18
---------------------------------------------------------------------------
  809-  823 (26.13/19.65)	TSLTYGK.LLEEVNNC
  825-  840 (22.49/15.74)	TANIYSSvLLHVIKHC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.06|      15|      18|    1121|    1135|      26
---------------------------------------------------------------------------
 1121- 1135 (23.76/16.11)	NILTTAGSANSLSSS
 1139- 1153 (26.30/18.82)	NMSVPQGAAVAHSNS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03668 with Med14 domain of Kingdom Viridiplantae
Unable to open file!