<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03653

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPTPAPAPAAVPPSASVPSTVVPPVAAPPSALLPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKLDVAGTSPVVSKEGVGFSNDELQSSGHSNAID
Length232
PositionMiddle
OrganismOryza nivara (Indian wild rice) (Oryza sativa f. spontanea)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza.
Aromaticity0.10
Grand average of hydropathy-0.464
Instability index57.37
Isoelectric point8.80
Molecular weight25824.15
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364129

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03653
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.80|      24|      27|      16|      39|       1
---------------------------------------------------------------------------
   16-   39 (44.32/28.50)	ARQRFLLELEFIQCL......ANPTYIHYL
   40-   69 (38.48/23.97)	AQNRYFEDEAFIGYLkylkywQRPEYIKYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.30|      11|      14|     134|     144|       3
---------------------------------------------------------------------------
  134-  144 (21.31/ 8.34)	PAAVPPSASVP
  150-  160 (20.98/ 8.12)	PVAAPPSALLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03653 with Med31 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKLDVAGTSPVVSKEGVGFSNDELQSSGHSNAID
169
232










Molecular Recognition Features






MoRF SequenceStartStop




1) FWKNYRNNRLK
106
116