Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MLAYYILDGSIYQAPQLCSVFASRIGYASHLKSFYYGMFKVGENWAWYVETEPDTAASESKTQKEAIDLKELKRVDHILMSLQRKLQPAPPPPPFPEGYVPSEQEKASDDLLASEALPPQIEHAPWNTPSPAALRRSVVCYRAAFC |
Length | 146 |
Position | Head |
Organism | Oryza nivara (Indian wild rice) (Oryza sativa f. spontanea) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.334 |
Instability index | 70.01 |
Isoelectric point | 5.59 |
Molecular weight | 16424.53 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03650 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 87.66| 24| 32| 73| 96| 1 --------------------------------------------------------------------------- 73- 96 (46.87/28.39) KRVDHILMS..LQRKLQPAPPPPPFP 106- 131 (40.79/23.81) KASDDLLASeaLPPQIEHAPWNTPSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FPEGYVPSEQ 2) KTQKEAIDLKELKRVDHILMSLQRKLQPAP | 95 61 | 104 90 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab