Description | Uncharacterized protein |
Sequence | MGLDVIGPWWIERRRREKERERRRRRSPAARRGRRSPEMDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAAAAANPNPDDPAQPQPGAAAAAAPGAPAAQAQAPPAQAQPPALDLAEHPKAMSHALVLAAKKFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHCINLKKPE |
Length | 212 |
Position | Middle |
Organism | Oryza meridionalis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.635 |
Instability index | 79.29 |
Isoelectric point | 5.77 |
Molecular weight | 23169.96 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP03557 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.62| 14| 15| 86| 99| 1 --------------------------------------------------------------------------- 86- 99 (29.62/11.89) AAANPNPDDP.AQPQ 102- 116 (21.00/ 6.61) AAAAAAPGAPaAQAQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 88.72| 25| 25| 148| 172| 2 --------------------------------------------------------------------------- 126- 145 (21.88/11.39) .....AL..DLAEHPKAMSHALVLAAK 148- 172 (36.73/23.76) DALVSAL..PLSSEEDQLKRIKELQAE 174- 200 (30.12/18.25) EVVGSELqkQLEAAELELKQVEALFNE --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) LQRDAPPVRLSNNYPDPLNPAAAAAANPNPDDPAQPQPGAAAAAAPGAPAAQAQAPPAQAQPPALDLAEHPKA 2) WIERRRREKERERRRRRSPAARRGRRSPEMDIISQLQEQ | 63 10 | 135 48 |
MoRF Sequence | Start | Stop |
1) MGLDVIGPWWIE | 1 | 12 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab