<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03557
Description |
Uncharacterized protein |
Sequence | MGLDVIGPWWIERRRREKERERRRRRSPAARRGRRSPEMDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAAAAANPNPDDPAQPQPGAAAAAAPGAPAAQAQAPPAQAQPPALDLAEHPKAMSHALVLAAKKFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHCINLKKPE |
Length | 212 |
Position | Middle |
Organism | Oryza meridionalis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.635 |
Instability index | 79.29 |
Isoelectric point | 5.77 |
Molecular weight | 23169.96 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP03557
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.62| 14| 15| 86| 99| 1
---------------------------------------------------------------------------
86- 99 (29.62/11.89) AAANPNPDDP.AQPQ
102- 116 (21.00/ 6.61) AAAAAAPGAPaAQAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.72| 25| 25| 148| 172| 2
---------------------------------------------------------------------------
126- 145 (21.88/11.39) .....AL..DLAEHPKAMSHALVLAAK
148- 172 (36.73/23.76) DALVSAL..PLSSEEDQLKRIKELQAE
174- 200 (30.12/18.25) EVVGSELqkQLEAAELELKQVEALFNE
---------------------------------------------------------------------------
|