Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEPEAMPAPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIRYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPAPAPAPVPAPATVPPAAPVPSTVVPPVAAPSSSLPPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKKDG |
Length | 203 |
Position | Middle |
Organism | Oryza meridionalis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.509 |
Instability index | 67.56 |
Isoelectric point | 9.54 |
Molecular weight | 22949.24 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03555 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.44| 18| 18| 122| 139| 1 --------------------------------------------------------------------------- 122- 139 (36.85/14.25) PEPAPAPAPVPAP.ATVPP 142- 160 (30.59/10.74) PVPSTVVPPVAAPsSSLPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.12| 22| 29| 33| 61| 2 --------------------------------------------------------------------------- 12- 37 (31.43/28.64) NDARQRFLLELEFIQclaNPtYIHYL 45- 67 (38.69/18.40) DEAFIRYLKYLKYWQ...RPeYIKYI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FFWKNYRNNRLKH 2) QGGRKRKKD | 103 194 | 115 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab