Description | Uncharacterized protein |
Sequence | MECVVQGIIETQHVDALEVLLQGLSGVPKERVRVHELCLKSGPNLGVVPSEVRLLCDLAQSTPSCQYSCRTIRHVGGAMRGAGAEQISVLVRSIVESKASNNVLRYFYGIGYKLDHEVLKGGFAFRFHRGAQITVAVTSVSKMTKLHATNEAVPITPAIQLVEIMAPAAADNYNDVVSAVTSFCEYLAPLLHLSKPGNSTGIVPTAGAAAASLMSSGGGGGGGGGKTL |
Length | 228 |
Position | Head |
Organism | Oryza meridionalis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.05 |
Grand average of hydropathy | 0.200 |
Instability index | 35.30 |
Isoelectric point | 8.22 |
Molecular weight | 23801.17 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblPlants |
GO - Biological Process | carpel development GO:0048440 IEA:EnsemblPlants negative regulation of transcription, DNA-templated GO:0045892 IEA:EnsemblPlants petal development GO:0048441 IEA:EnsemblPlants production of miRNAs involved in gene silencing by miRNA GO:0035196 IEA:EnsemblPlants regulation of defense response to fungus GO:1900150 IEA:EnsemblPlants regulation of DNA-templated transcription, elongation GO:0032784 IEA:EnsemblPlants regulation of DNA-templated transcription, initiation GO:2000142 IEA:EnsemblPlants regulation of DNA-templated transcription, termination GO:0031554 IEA:EnsemblPlants regulation of histone H3-K36 trimethylation GO:2001253 IEA:EnsemblPlants regulation of photoperiodism, flowering GO:2000028 IEA:EnsemblPlants regulation of salicylic acid mediated signaling pathway GO:2000031 IEA:EnsemblPlants regulation of timing of transition from vegetative to reproductive phase GO:0048510 IEA:EnsemblPlants regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro regulation of vernalization response GO:0010219 IEA:EnsemblPlants response to abscisic acid GO:0009737 IEA:EnsemblPlants response to ethylene GO:0009723 IEA:EnsemblPlants sepal development GO:0048442 IEA:EnsemblPlants specification of floral organ number GO:0048833 IEA:EnsemblPlants stamen development GO:0048443 IEA:EnsemblPlants |
Binary Interactions |
Repeats | >MDP03502 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) AAAASLM 2) GGGGKTL | 208 222 | 214 228 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab