<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03493
Description |
Uncharacterized protein |
Sequence | MDQHHVQQQQYVDPYRTMVLSPQPDHLNALQYNHQQQPQPPPQATPPPPQHHHASLASHFHLLHLTTRLADAIGKGTRDQNSDALVEDLTSRFARCQQLLNSISGELSSKSIVGLGLRHGLRSGLIHVSSWCVLMVAVVRDTRSVCDVSGWSSARASTCRCPVDMPAA |
Length | 168 |
Position | Middle |
Organism | Oryza meridionalis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.401 |
Instability index | 47.55 |
Isoelectric point | 7.79 |
Molecular weight | 18547.75 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP03493
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.46| 15| 26| 3| 17| 2
---------------------------------------------------------------------------
3- 17 (29.62/14.76) QHHVQQQQYVDPYRT
31- 45 (30.84/15.61) QYNHQQQPQPPPQAT
---------------------------------------------------------------------------
|