<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03490
| Description |
Uncharacterized protein |
| Sequence | MDQHHVQQQQYVDPYRTMVLSPQPDHLNALQYNHQQQPQPPPQATPPPPQHHHASLASHFHLLHGKDVMTNFGCRSAGCPCSLAARCRSAAVMLPAAG |
| Length | 98 |
| Position | Middle |
| Organism | Oryza meridionalis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.640 |
| Instability index | 53.30 |
| Isoelectric point | 7.82 |
| Molecular weight | 10831.13 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03490
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.26| 21| 25| 3| 26| 1
---------------------------------------------------------------------------
3- 26 (33.43/16.64) QHHVQQQQYVDPYRTmvLSPqPDH
31- 51 (45.83/15.55) QYNHQQQPQPPPQAT..PPP.PQH
---------------------------------------------------------------------------
|