<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03485
Description |
Uncharacterized protein |
Sequence | MSKSGGAAAGPTAAAAAAAVQKQKTLLQKADADVSSLVDNFAALINIARVNDPPVRNTQEAFQMDMRGSRLIHSADSLLKLVSELKRTAIFSGLASLTENVDRRIEILSQQAEGTERMLERIGQEAAGSLKELEAHYYSSVKNYDTIFTFSTSSCIVKCQFQHTSVSCDEEDRKKCMVSCHFTVLFPFESLFIALSLLDLFVHYFYSPFPIFLFFIDLF |
Length | 219 |
Position | Head |
Organism | Oryza meridionalis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.10 |
Grand average of hydropathy | 0.073 |
Instability index | 52.28 |
Isoelectric point | 5.74 |
Molecular weight | 24299.53 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03485
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.60| 14| 15| 188| 201| 1
---------------------------------------------------------------------------
188- 201 (25.07/12.46) FESLF.IALSLLDLF
205- 219 (24.53/12.07) FYSPFpIFLFFIDLF
---------------------------------------------------------------------------
|