<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03476
| Description |
Uncharacterized protein |
| Sequence | MDITYKALQETDIGRHVNGLRKHPSGEVRLLVKQLIRKWKEIVDDWVRLHNSSGDASNSIITDGNSPEKIQGKNQQSSQVSEFKYSPSPSRHNNSSSERVSNGIASIAATKHRASPAPAHHNARQINNTHHSTTSSAPARMVKEQKDSHLDLERLDSARKRLQENYQEAQNAKKQRTIQVMDINEIPKPKNRNAFIRKGNGGGF |
| Length | 204 |
| Position | Unknown |
| Organism | Oryza glumipatula |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.066 |
| Instability index | 52.05 |
| Isoelectric point | 10.07 |
| Molecular weight | 22928.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03476
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.45| 17| 18| 102| 119| 1
---------------------------------------------------------------------------
102- 119 (26.47/20.56) NGiASIAATKH.RASPAPA
122- 139 (26.98/15.99) NA.RQINNTHHsTTSSAPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.81| 19| 28| 143| 161| 2
---------------------------------------------------------------------------
143- 161 (29.93/16.26) KEQKDSH.LDLERLDSARKR
173- 192 (27.87/14.78) KKQRTIQvMDINEIPKPKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.26| 16| 18| 66| 81| 3
---------------------------------------------------------------------------
66- 81 (27.68/16.29) SPEKIQGKNQQSSQVS
86- 101 (28.58/17.03) SPSPSRHNNSSSERVS
---------------------------------------------------------------------------
|