<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03469

Description Uncharacterized protein
SequenceMGSRGGDADAWETASARSGVSSSSSGRATAAAAAAAPENKVFVALPAQHKSGRSTLAWALRHVADLAPAAIGGGGEVVVVAAHVHSPAQMIPMSMGGKFHASKLRPEQVSTYRKYEREQVEKNLDEYLEQCTKMKVKCEKIVIENEDIANGITELILLHGVSKLVMGAAADKQYSRKMKLPKSKTALSVMVKANPSCKIWFVCKEHLIYTRDFVAPISPNSQSPDTIRGSMSNLAARGGTTNQYANNAVNGYVQRSMSEMVVPASSRVSLQLHSRSSLQESLSRLNMEGTSVDSWDSFRRGSFPSSYRASSTVTEEVLSDSSSSGIPRDGISTLAGFDFPNSALHHEQESDSITWCCIQGDAGSNANLFDKLEEAFAEAEKYRKQTYDESLRRQKTEEELISYHQKARKSEDLFLNEAKQRKEVEETLAKANVEIQLLKEEMDALKHNRDDLSSKLFEVSEQKVTLEQQAVEYGSIIIDLKDTVAASQVLIDSMQMEFEQLKHERDNALKHAEELHREKQNMVSSSDLEWSTEFSLLELQQATQNFSDAMKIGEGGFGCVYRGQLRNTTVAIKMLRSQNLQGQSQFQQEVAVLSRVRHPNLVTLVGYCSEASGLVYEFLPNGSLEDHLACENNTSPLTWQIRTRIIGEICSALIFLHSDKPHAVIHGDLKPANILLDANLVSKLGDFGISRLLNRSSTVSTSFYQTTNPRGTFAYMDPEFLTTGELTARSDIYSFGIIILRLVTGKPALGIAREVEVALDKGELELLVDRSAGDWPFVQAEKLMLLGLQCAELSRRKRPDRMNHVWSVVEPLVKSASLPVEPESIGHWVNKNRTPFYFICPISQEVMRDPHIAADGFSYEEEAIKGWLGSGHNTSPMTKSTLEHLQLIPNLALRSAIEEFMQQKQQQIPS
Length910
PositionTail
OrganismOryza glumipatula
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza.
Aromaticity0.07
Grand average of hydropathy-0.367
Instability index47.98
Isoelectric point5.93
Molecular weight100898.94
Publications

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP03469
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.25|      17|     383|     498|     525|       1
---------------------------------------------------------------------------
  438-  454 (31.48/ 7.29)	LKEEMD.ALKH....NRDD...LSS
  501-  525 (16.77/31.76)	LKHERDnALKHaeelHREKqnmVSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     121.11|      36|     383|     301|     341|       2
---------------------------------------------------------------------------
  288-  323 (59.77/42.55)	EGTSVDSWDSFRRGSFPSSYRASSTVTEEVLSDSSS
  329-  364 (61.34/32.82)	DGISTLAGFDFPNSALHHEQESDSITWCCIQGDAGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.09|      25|     238|     611|     638|       3
---------------------------------------------------------------------------
  611-  638 (40.16/29.60)	ASGLVYEflpNGSLEDHLACENNTSPLT
  854-  878 (47.93/26.85)	ADGFSYE...EEAIKGWLGSGHNTSPMT
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP03469 with Med32 domain of Kingdom Viridiplantae

Unable to open file!