<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03468
Description |
Uncharacterized protein |
Sequence | MEATVDELSEAYQEFVAAAAAVVEARGQSGGEKNAATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGASSSSSAALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGASAAGPGGGGGAAAAASGAAGQHGHGGVDTRFPEDGAQ |
Length | 160 |
Position | Tail |
Organism | Oryza glumipatula |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.113 |
Instability index | 48.80 |
Isoelectric point | 4.77 |
Molecular weight | 16102.53 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03468
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.21| 13| 114| 18| 30| 1
---------------------------------------------------------------------------
18- 30 (21.43/ 7.61) AAAAVVEARGQSG
120- 132 (20.54/ 7.00) AGGASAAGPGGGG
134- 146 (23.25/ 8.85) AAAAASGAAGQHG
---------------------------------------------------------------------------
|