<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03466
| Description |
Uncharacterized protein |
| Sequence | MRVPELCRNFSAVAWCGKLNAIACASETCARIPSSNSSPPFWIPIHILNPERPTECSVFNVKADSPRDFVQFIEWSPRSCPRALLVANFHGRITIWTQPTKGPTNLVRDASSWQCEHEWRQDLSVVTKWLSGISPYRWLPANSSTSSNLKTFEEKFLTQQPQSSASLVTMAFSKLSTT |
| Length | 178 |
| Position | Tail |
| Organism | Oryza glumipatula |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.272 |
| Instability index | 57.82 |
| Isoelectric point | 8.96 |
| Molecular weight | 20046.62 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03466
No repeats found
|