Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDGGAATNASGVAAAAAAAGNGVQAGGGGERAEDASKQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEAYREIRATAAAESKQLAQSQSALPNGDVKHSSIHHWKKA |
Length | 195 |
Position | Middle |
Organism | Oryza glumipatula |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.349 |
Instability index | 33.02 |
Isoelectric point | 5.86 |
Molecular weight | 20729.04 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03454 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.59| 13| 16| 46| 58| 1 --------------------------------------------------------------------------- 46- 58 (22.61/16.38) SIQRTLGLLHQLN 65- 77 (21.98/15.74) SSASQLPLLQRLN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.21| 14| 16| 4| 17| 2 --------------------------------------------------------------------------- 4- 17 (21.31/11.34) GAATNASGVAAAAA 22- 35 (23.89/13.51) GVQAGGGGERAEDA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AATNASGVAAAAAAA 2) VKHSSIHHWKKA | 5 184 | 19 195 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab