Description | Uncharacterized protein |
Sequence | MSKSGGAAAGPTAAAAAAAVQKQKTLLQKADADVSSLVDNFAALINIARVNDPPVRNTQEAFQMDMRGSRMVHSADSLLKLVSELKRTAIFSGLASLTENVDRRIEIFSQQVEGTERMLERIGQEATGSLKELEAHYYSSVVRTPPDE |
Length | 148 |
Position | Head |
Organism | Oryza glumipatula |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.272 |
Instability index | 40.65 |
Isoelectric point | 5.74 |
Molecular weight | 15961.85 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03446 No repeats found |
MoRF Sequence | Start | Stop |
1) GPTAAAAAAAVQK 2) RIEIF 3) RMLERI | 10 104 117 | 22 108 122 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab