<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03439
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAAAAANPNPDDPAQPQPGAAAAAPGAPAAQAQAPPAQAQPPALDLAEHPKAMSHALVLAAKKFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHCINLKKPE |
| Length | 173 |
| Position | Middle |
| Organism | Oryza glumipatula |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.356 |
| Instability index | 50.95 |
| Isoelectric point | 4.57 |
| Molecular weight | 18302.43 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03439
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.55| 15| 15| 40| 54| 1
---------------------------------------------------------------------------
40- 54 (29.72/11.31) DPLNP..AAAAAANPNP
56- 72 (23.84/ 7.68) DPAQPqpGAAAAAPGAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.72| 25| 25| 109| 133| 2
---------------------------------------------------------------------------
87- 106 (21.88/ 9.48) .....AL..DLAEHPKAMSHALVLAAK
109- 133 (36.73/20.15) DALVSAL..PLSSEEDQLKRIKELQAE
135- 161 (30.12/15.40) EVVGSELqkQLEAAELELKQVEALFNE
---------------------------------------------------------------------------
|