<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03407
| Description |
Uncharacterized protein |
| Sequence | MTRHLIKSCLSSSFCTWAYTAQPVRGGLLVTLPPCPPLPPPAIPIHPASEQGAVVLPATSILVSTSSATADPQPSRERASDRRSSCCFRHIGGPWTCTLQMSGFNRMGSDGNFGKGPRELTGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLHNVVGDTEIRKGEGMELDQLFQDAYLREKTSYIQPFDMETLGQAFQLRETAPIDLPSAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKKRKQEGLEDLASGHNPKKVTLIF |
| Length | 318 |
| Position | Head |
| Organism | Oryza glumipatula |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.957 |
| Instability index | 45.04 |
| Isoelectric point | 9.61 |
| Molecular weight | 35820.53 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03407
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.05| 15| 15| 232| 246| 1
---------------------------------------------------------------------------
232- 246 (28.72/13.64) KKHKRHKEKDKDKYK
249- 262 (26.62/12.16) KKHK.HRHKDRSKDK
264- 276 (19.71/ 7.31) K..EKEKEKEKEKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.71| 15| 20| 174| 192| 2
---------------------------------------------------------------------------
174- 192 (23.01/27.22) LFQDAYLREKTsyiqPFDM
195- 209 (26.69/18.34) LGQAFQLRETA....PIDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.72| 15| 15| 282| 296| 3
---------------------------------------------------------------------------
282- 296 (26.81/14.48) HDSG.ADRSKKHHEKK
298- 313 (21.91/10.64) KQEGlEDLASGHNPKK
---------------------------------------------------------------------------
|