<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03407

Description Uncharacterized protein
SequenceMTRHLIKSCLSSSFCTWAYTAQPVRGGLLVTLPPCPPLPPPAIPIHPASEQGAVVLPATSILVSTSSATADPQPSRERASDRRSSCCFRHIGGPWTCTLQMSGFNRMGSDGNFGKGPRELTGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLHNVVGDTEIRKGEGMELDQLFQDAYLREKTSYIQPFDMETLGQAFQLRETAPIDLPSAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKKRKQEGLEDLASGHNPKKVTLIF
Length318
PositionHead
OrganismOryza glumipatula
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza.
Aromaticity0.06
Grand average of hydropathy-0.957
Instability index45.04
Isoelectric point9.61
Molecular weight35820.53
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03407
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.05|      15|      15|     232|     246|       1
---------------------------------------------------------------------------
  232-  246 (28.72/13.64)	KKHKRHKEKDKDKYK
  249-  262 (26.62/12.16)	KKHK.HRHKDRSKDK
  264-  276 (19.71/ 7.31)	K..EKEKEKEKEKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.71|      15|      20|     174|     192|       2
---------------------------------------------------------------------------
  174-  192 (23.01/27.22)	LFQDAYLREKTsyiqPFDM
  195-  209 (26.69/18.34)	LGQAFQLRETA....PIDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.72|      15|      15|     282|     296|       3
---------------------------------------------------------------------------
  282-  296 (26.81/14.48)	HDSG.ADRSKKHHEKK
  298-  313 (21.91/10.64)	KQEGlEDLASGHNPKK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03407 with Med19 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LRETAPIDLPSAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKKRKQEGLEDLASGHNPKKVTLIF
201
318










Molecular Recognition Features






MoRF SequenceStartStop




1) KDKDKYKDQKKHKHRHKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKKRKQEGLEDLA
240
306