<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03373
| Description |
Uncharacterized protein |
| Sequence | MDYDGKKFGKGPRELTGAVDLISHYKLLSHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKNESKDKEKKHKKHKDKDRDKDKEHKKHKHRHKDRSKEKDKDKDKDKDKDKDKDKKKDKSGHHDSGGDHSKKHHEKKVSVVKIHRSRDFVLQFP |
| Length | 212 |
| Position | Head |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Leersia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.478 |
| Instability index | 29.76 |
| Isoelectric point | 9.45 |
| Molecular weight | 24650.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03373
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.14| 18| 27| 133| 158| 1
---------------------------------------------------------------------------
134- 151 (35.99/ 6.36) DKDRDKDKEHKKHK......HRHK
182- 205 (25.15/ 8.51) DSGGDHSKKHHEKKvsvvkiHRSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.13| 15| 43| 119| 133| 3
---------------------------------------------------------------------------
119- 133 (26.88/ 9.78) KNESKDKEKKHKKHK
163- 177 (26.25/ 9.39) KDKDKDKDKDKKKDK
---------------------------------------------------------------------------
|