| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEPEERPAPDPNDAKQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPPPEPTPAPAAAPATMPPAAPVPSSVVPPVAAPPSSFPAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKIG |
| Length | 199 |
| Position | Middle |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Leersia. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.539 |
| Instability index | 65.37 |
| Isoelectric point | 9.44 |
| Molecular weight | 22509.67 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP03363
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.19| 22| 27| 118| 139| 1
---------------------------------------------------------------------------
118- 139 (47.87/15.65) PRP....PP.PPEPTPAPAAAPATMPP
142- 168 (34.32/ 9.41) PVPssvvPPvAAPPSSFPAAGASAMSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.87| 20| 28| 18| 37| 2
---------------------------------------------------------------------------
18- 37 (37.00/19.64) FLLELEFVQCLANPTYIHYL
48- 67 (36.88/19.56) FIGYLKYLKYWQRPEYIKYI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FFWKNYRNNRLK 2) QGGRKRKIG | 103 191 | 114 199 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab