Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEPEERPAPDPNDAKQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPPPEPTPAPAAAPATMPPAAPVPSSVVPPVAAPPSSFPAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKIG |
Length | 199 |
Position | Middle |
Organism | Leersia perrieri |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Leersia. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.539 |
Instability index | 65.37 |
Isoelectric point | 9.44 |
Molecular weight | 22509.67 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03363 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.19| 22| 27| 118| 139| 1 --------------------------------------------------------------------------- 118- 139 (47.87/15.65) PRP....PP.PPEPTPAPAAAPATMPP 142- 168 (34.32/ 9.41) PVPssvvPPvAAPPSSFPAAGASAMSP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.87| 20| 28| 18| 37| 2 --------------------------------------------------------------------------- 18- 37 (37.00/19.64) FLLELEFVQCLANPTYIHYL 48- 67 (36.88/19.56) FIGYLKYLKYWQRPEYIKYI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FFWKNYRNNRLK 2) QGGRKRKIG | 103 191 | 114 199 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab