<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03359
Description |
Uncharacterized protein |
Sequence | MEATVDELSEAYSEFVAAAAAVVEARAQAGGEKTPATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGATSSSSSAAALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGGASAAGPGGGGGGAGAGAAAASGVAGQHGHGGVDARFGEDGAQ |
Length | 167 |
Position | Tail |
Organism | Leersia perrieri |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Leersia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.023 |
Instability index | 45.43 |
Isoelectric point | 4.77 |
Molecular weight | 16501.97 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03359
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.09| 15| 30| 119| 133| 3
---------------------------------------------------------------------------
119- 133 (30.35/13.24) QHGAGGGASAAGPGG
151- 165 (28.75/12.12) QHGHGGVDARFGEDG
---------------------------------------------------------------------------
|