<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03348

Description Uncharacterized protein
SequenceMDAAALGAAPAAGAPIPAAAVGDQQQQQAAAAAPRAERLSAGVQQQLNLEGMRARAVGLYKAISRILEDFDAIARTNPNATPKWQDVLGQYSMVSMELFNIVEDIKKVSKVFVVYPRNVNAENATILPVMLSSKLLPEMEVEETTKRETLLSGITNLPVPAQIEKLKARIDMIGSACETAEKVIADCRKTYGLGARQGTNLGPTLDKAQAAKIQEQEGLLRAAVNYGEGLRVPGDQRQMSSLPSHLVDVLPFGDGAHNFGDNSGVYPKNTSTFVPNVVNAQGNPMQVSGGQLLGRPAPSPGATGTPNFENVSTPPMPYANSPRSGTNMMNTPSPQQHLTPQQHRQKLMQTSQQQQLHTQQQLRPSAAGMLAQSTMPQLQDLQGQSQQKLQVPGQQQMQYNQALSQQYQNRQMQAGRMQPGMTQNQLNQGNQLRSHISQFTGAANSAMFTAAQASSNSQMMANIPGTMQSQSLLPQMQTLNQYNLTGGHPQRNHPSQMLTDQMFTMGGTNTTGLMGMQQQQQQGVYSNMQTNAQNLQGMTGLQNQQQNPNFPQQRQQNQQ
Length559
PositionHead
OrganismLeersia perrieri
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Leersia.
Aromaticity0.04
Grand average of hydropathy-0.620
Instability index48.51
Isoelectric point9.21
Molecular weight60694.70
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
defense response to fungus	GO:0050832	IEA:EnsemblPlants
regulation of flower development	GO:0009909	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03348
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     206.96|      23|      24|     379|     401|       1
---------------------------------------------------------------------------
  345-  366 (33.28/10.05)	QKLMQTSQQQ.QLHTQQQLRPSA
  379-  401 (42.12/14.81)	QDLQGQSQQKLQVPGQQQMQYNQ
  408-  428 (34.19/10.54)	QNRQMQA.GRMQ.PGMTQNQLNQ
  477-  496 (29.64/ 8.09)	QTL...NQYNLTGGHPQRNHPSQ
  514-  536 (31.40/ 9.04)	MGMQQQQQQGVYSNMQTNAQNLQ
  539-  558 (36.32/11.69)	TGLQNQ.QQNPNFP..QQRQQNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.17|      21|      23|     185|     205|       3
---------------------------------------------------------------------------
  167-  193 (27.17/13.67)	KARIDM.IGSACetaekviADCRKTYGL
  194-  219 (29.29/15.28)	GARQGTNLGPTL..dkaqaAKIQEQEGL
  220-  242 (20.71/ 8.74)	.LRAAVNYGEGL....rvpGDQRQMSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      67.96|      18|      18|     298|     315|       4
---------------------------------------------------------------------------
  267-  282 (20.46/ 6.62)	...............PKNTSTFVP.NVVNAQG
  283-  313 (23.76/ 8.68)	NPmqvsggqllgrpaPSPGATGTP.NFENVST
  314-  333 (23.74/ 8.68)	PP............mPYANSPRSGtNMMNTPS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03348 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HNFGDNSGVYPKNTSTFVPNVVNAQGNPMQVSGGQLLGRPAPSPGATGTPNFENVSTPPMPYANSPRSGTNMMNTPSPQQHLTPQQHRQKLMQTSQQQQLHTQQQLRPSAAGMLAQSTMPQLQDLQGQSQQKLQVPGQQQMQYNQALSQQYQNRQMQAGRMQPGMTQNQLNQGNQLRSHISQFTGAANSAMFTAAQASSNSQMMANIPGTMQSQSLLPQMQTLNQYNLTGGHPQRNHPSQMLTDQMFTMGGTNTTGLMGMQQQQQQGVYSNMQTNAQNLQGMTGLQNQQQNPNFPQQRQQNQQ
257
559










Molecular Recognition Features






MoRF SequenceStartStop




NANANA