Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDGGGAASNASGIAAAAAGNGVQAGAGGERAEDASKQNLAQVTASIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEQYREIRATSAAESKRLAQSQSALPNGDVKVKPEH |
Length | 189 |
Position | Middle |
Organism | Leersia perrieri |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Leersia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.369 |
Instability index | 30.29 |
Isoelectric point | 5.26 |
Molecular weight | 20022.20 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03346 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.31| 13| 16| 45| 60| 2 --------------------------------------------------------------------------- 45- 57 (22.36/15.78) SIQKTLGLLHQLN 64- 76 (21.95/ 7.67) SSASQLPLLQRLN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ASGIAAAAAG 2) EDVEQYREIRAT 3) FTRDVI 4) GDVKVKPEH 5) KRLAQS 6) LRKHLL | 10 152 113 181 169 138 | 19 163 118 189 174 143 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab