| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDGGGAASNASGIAAAAAGNGVQAGAGGERAEDASKQNLAQVTASIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEQYREIRATSAAESKRLAQSQSALPNGDVKVKPEH |
| Length | 189 |
| Position | Middle |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Leersia. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.369 |
| Instability index | 30.29 |
| Isoelectric point | 5.26 |
| Molecular weight | 20022.20 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP03346
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.31| 13| 16| 45| 60| 2
---------------------------------------------------------------------------
45- 57 (22.36/15.78) SIQKTLGLLHQLN
64- 76 (21.95/ 7.67) SSASQLPLLQRLN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ASGIAAAAAG 2) EDVEQYREIRAT 3) FTRDVI 4) GDVKVKPEH 5) KRLAQS 6) LRKHLL | 10 152 113 181 169 138 | 19 163 118 189 174 143 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab