<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03344
| Description |
Uncharacterized protein |
| Sequence | MWARQRSRARDEKAAPAADLRRRRLTCGGGREEGRRQQPPVTVSPHLVRGLHCQEGKKKMDPHHVQQQQYVDPYRTMVLSPQPDHLNALQYNQQQPTSQATPPPPQHHHASLASHFHLLHLMTRLADAIGKGTRNQHSDALVEDLTSQFARCQQLLNSISGTLSSKSILKDKGKVWKKRSSSLIRGKAPLKDSSRGIQQDRNFKFWN |
| Length | 207 |
| Position | Middle |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Leersia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.979 |
| Instability index | 57.79 |
| Isoelectric point | 10.57 |
| Molecular weight | 23549.44 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03344
No repeats found
No repeats found
|