<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03341
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGLLVGFQPTRVNASPYKLREVFFYTHGPARKNPSPPPPPPSPSPSTHRLAAMPAIKWLMHWHPNPGATLNSQILAEACACAESLGGSKDGRPPSSSIARWPATAPRRRPXXPQPPPELPRELLGVALHERPGLYFSILRAHRLVLQADSAFPQVMEKLQSYKARVTLNFEGFQYQLGDFCLRIGKCVPNNSETLRGIMMEVEYYPLSSIEKSRAVMEDFFDIWQETVAKKSLPGHFIHVESNFSEYGLSDHYSFQHTAVQYATCLQQLMAAMFDVDWFARSMRPHGTGMVCRYGDQILLP |
| Length | 301 |
| Position | Head |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Leersia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.319 |
| Instability index | 67.42 |
| Isoelectric point | 8.87 |
| Molecular weight | 33636.31 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03341
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.08| 14| 74| 29| 43| 1
---------------------------------------------------------------------------
29- 43 (29.05/13.83) PA...RKNP.sPPPPPPSP
102- 120 (22.03/ 6.40) PAtapRRRPxxPQPPPELP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.73| 18| 37| 83| 100| 2
---------------------------------------------------------------------------
83- 100 (32.57/19.83) ESLGGSKDGRPP.SSSIAR
122- 140 (28.16/16.21) ELLGVALHERPGlYFSILR
---------------------------------------------------------------------------
|