<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03330
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAANPNTDDPAAQPQPGAAAAAAAVAAGAAPPPVPQAPPALDLTEQPKAMSHALVLAAKKFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHCINLKKPN |
| Length | 170 |
| Position | Middle |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Leersia.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.284 |
| Instability index | 54.78 |
| Isoelectric point | 4.50 |
| Molecular weight | 17984.14 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03330
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.05| 27| 35| 39| 70| 1
---------------------------------------------------------------------------
39- 70 (34.56/23.45) PDPLnPAAAnPNTDdpaAQPQPGAAAAAAAVA
75- 101 (50.49/19.34) PPPV.PQAP.PALD...LTEQPKAMSHALVLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.34| 21| 25| 110| 130| 3
---------------------------------------------------------------------------
110- 130 (33.49/24.45) SAL..PLSSEEDQLKRIKELQAE
136- 158 (27.85/19.15) SELqkQLEAAELELKQVEALFNE
---------------------------------------------------------------------------
|