Description | Uncharacterized protein |
Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAANPNTDDPAAQPQPGAAAAAAAVAAGAAPPPVPQAPPALDLTEQPKAMSHALVLAAKKFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHSQDHIAMRDMSKIHP |
Length | 177 |
Position | Middle |
Organism | Leersia perrieri |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Leersia. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.319 |
Instability index | 60.68 |
Isoelectric point | 4.53 |
Molecular weight | 18821.01 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP03329 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 85.05| 27| 35| 39| 70| 1 --------------------------------------------------------------------------- 39- 70 (34.56/24.22) PDPLnPAAAnPNTDdpaAQPQPGAAAAAAAVA 75- 101 (50.49/19.99) PPPV.PQAP.PALD...LTEQPKAMSHALVLA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.34| 21| 25| 110| 130| 3 --------------------------------------------------------------------------- 110- 130 (33.49/22.41) SAL..PLSSEEDQLKRIKELQAE 136- 158 (27.85/17.56) SELqkQLEAAELELKQVEALFNE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAAAAVAAGAA 2) VPQAPPALDLTEQ | 64 78 | 74 90 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab