<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03309
| Description |
Uncharacterized protein |
| Sequence | MASAAARRRQEMAAEGQRHLEETIAAAFQILSSMNDELCNPALWSSSSSSPAAAGGGGLQHHGNHPHHPPPLLQSGDSDASDGAGGGPGGGAPGSGGSLDEARHRYKVAVAALRASIAAVSSCTQEIGSTEYKADQAEIERLEEHASALRKEIESKNKHVKLLIDQLRDLISDISMWQSPCSM |
| Length | 183 |
| Position | Head |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Leersia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.480 |
| Instability index | 73.42 |
| Isoelectric point | 5.67 |
| Molecular weight | 19173.00 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03309
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.25| 17| 28| 41| 57| 1
---------------------------------------------------------------------------
41- 57 (32.43/16.94) PALWSSSSSSPAAAGGG
71- 87 (31.83/16.49) PLLQSGDSDASDGAGGG
---------------------------------------------------------------------------
|