<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03307
| Description |
Uncharacterized protein |
| Sequence | MSGFNRMGSDGNFGRGPRELTGAVDLISRYQLLNHHSFFCKKPLPLAISDTNYLHNVVGDTEIRKGEGMELDQLFQDAYLREKTSYIQPFDMETLGQAFQLRETAPVDLSSAEKGTPTISGKPKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRSKDKDKDKEKEKEKEKEKKKDKSVHHDLGGDRSKKHHEKKRKHEGVEDLASGGHNHKKATSNGNFTKLATSKMIVVSMDNVQQFW |
| Length | 243 |
| Position | Head |
| Organism | Leersia perrieri |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Leersia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.330 |
| Instability index | 25.20 |
| Isoelectric point | 9.66 |
| Molecular weight | 28002.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03307
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.86| 14| 15| 133| 147| 1
---------------------------------------------------------------------------
123- 140 (20.39/ 8.09) PKIKSKdkvkKHKRHKEK
187- 200 (22.48/ 7.86) GGDRSK....KHHEKKRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.15| 20| 20| 142| 161| 2
---------------------------------------------------------------------------
142- 161 (36.90/13.66) KDKYKDQKKHKHRHKDRSKD
164- 183 (33.24/11.75) KDKEKEKEKEKEKKKDKSVH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.56| 15| 20| 74| 92| 3
---------------------------------------------------------------------------
74- 92 (22.99/28.25) LFQDAYLREKTsyiqPFDM
95- 109 (26.57/19.03) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|