<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03270
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASSSGEKEKERLGGGLGVASGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD |
| Length | 270 |
| Position | Middle |
| Organism | Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Chlorocebus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.612 |
| Instability index | 50.73 |
| Isoelectric point | 5.02 |
| Molecular weight | 29748.10 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
transcription by RNA polymerase II GO:0006366 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP03270
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.34| 12| 24| 25| 36| 1
---------------------------------------------------------------------------
25- 36 (19.54/10.37) STRERLLSALED
51- 62 (18.80/ 9.75) SRNQKLLQAGEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 116.27| 28| 28| 94| 121| 2
---------------------------------------------------------------------------
64- 91 (37.82/22.57) QVLELLI.HRDGEFQELMKlALNQGKIHH
94- 121 (43.48/26.88) QVLEKEVEKRDSDIQQLQK.QLKEAEQIL
124- 149 (34.98/20.41) AVYQAK.EKLKS.IEKARK.GAISSEEII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.54| 23| 23| 216| 238| 3
---------------------------------------------------------------------------
216- 238 (43.71/24.22) LAPQYPWQSSDMSMNMLPPNHSS
242- 264 (38.82/20.85) LEPPGHNKENEDDVEIMSTDSSS
---------------------------------------------------------------------------
|