<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03236
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEQEPHSLASTFPNPPPFWKDFTPDRVARIDELRSVFAGGASDHASSSVVRIPGLPEELTNLQPPPEPSDGRWRVFGDQYMLDDKLPTLEEQGITNLPTTGLSDSKDAKHYDRAFELKKLVKSLLLNFLELAGTLSRNPAHAEGKIQDLRTLFINIHHILNEYRPHQARESAIAMMQDHLDKTRSETDAIRMQVEKAKSVLEGLGKLGQGDVELAGEEGAGEAGDETENMRIRREMDLWAAADAEFAL |
| Length | 249 |
| Position | Middle |
| Organism | Metarhizium anisopliae BRIP 53293 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.574 |
| Instability index | 46.91 |
| Isoelectric point | 4.96 |
| Molecular weight | 27735.79 |
| Publications | PubMed=25102932
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03236
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.65| 13| 50| 6| 18| 1
---------------------------------------------------------------------------
6- 18 (26.78/14.80) PHSLASTFPNPPP
57- 69 (25.88/14.11) PEELTNLQPPPEP
---------------------------------------------------------------------------
|