Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAEQEPHSLASTFPNPPPFWKDFTPDRVARIDELRSVFAGGASDHASSSVVRIPGLPEELTNLQPPPEPSDGRWRVFGDQYMLDDKLPTLEEQGITNLPTTGLSDSKDAKHYDRAFELKKLVKSLLLNFLELAGTLSRNPAHAEGKIQDLRTLFINIHHILNEYRPHQARESAIAMMQDHLDKTRSETDAIRMQVEKAKSVLEGLGKLGQGDVELAGEEGAGEAGDETENMRIRREMDLWAAADAEFAL |
Length | 249 |
Position | Middle |
Organism | Metarhizium anisopliae BRIP 53293 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.574 |
Instability index | 46.91 |
Isoelectric point | 4.96 |
Molecular weight | 27735.79 |
Publications | PubMed=25102932 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03236 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.65| 13| 50| 6| 18| 1 --------------------------------------------------------------------------- 6- 18 (26.78/14.80) PHSLASTFPNPPP 57- 69 (25.88/14.11) PEELTNLQPPPEP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RWRVFGDQYML 2) WKDFTPDRVAR | 73 20 | 83 30 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab