<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03235
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDDSPHKRKRSLGDTGDRDRDQKKMHLGDSRLGIEDLHLDVGEKYLLCRTPHPEPVTRIAQDLYELCGLTSLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEDAPSEFMAILQVPELEWNVHQVKGREITDGLSATTLSNLGRAMNMSKGPIPKPVWDSSVLGDLAPSSGNASKPISAKPSAPGTPLASTPNTIGRPKPPILAGQDPNRPRRNVKKRSYGDSSFEGYGEGYPDDDGGMDTGYSTGEGEGGQKRRKKVGYDSTNGNESLSSDMALKNTAASPPNALMRQQSYGPGMVGA |
| Length | 309 |
| Position | Head |
| Organism | Metarhizium anisopliae BRIP 53293 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.868 |
| Instability index | 48.57 |
| Isoelectric point | 8.99 |
| Molecular weight | 33375.02 |
| Publications | PubMed=25102932
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03235
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.44| 18| 18| 177| 194| 1
---------------------------------------------------------------------------
177- 194 (32.62/18.12) APSSGNASKPISA..KPSAP
202- 221 (28.82/15.19) PNTIGRPKPPILAgqDPNRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 157.24| 48| 239| 3| 52| 2
---------------------------------------------------------------------------
3- 52 (77.28/47.03) DDSPHKRKRSLGDtGDRDRDQKKmHLG.DSRLGIEDLHLDVGEKYLLCRTP
245- 293 (79.96/41.05) DDGGMDTGYSTGE.GEGGQKRRK.KVGyDSTNGNESLSSDMALKNTAASPP
---------------------------------------------------------------------------
|