<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03226

Description Uncharacterized protein
SequenceMSGRHVSTPRRQGSKLRLELSNELISAGPISATESPQTLTPSRMMPLPDPMETDNMSPALSRVSQQDSDNPPMPMPRRRLPQTSQAIPSTRPAAPTPASTKKDARPKPYTVEVPTAAPRYVNTNKHETIGRDPFSKGLFSGNADFFPWSGNHHEDEWSTEAIQKGTWDRGSQNEASSARIAIFPALKQRSGLNALSTLFMGVLNQRRIRGQITAPSTFKPPPRVTLTDTKREIWLKDLANPAISLRRLSRTIPHGIRGRTLLDQCLNKDVPTERAVWLAKCVGANEIRAFKRKGASGAFVLGGELKWIRDWTVFVEQFIESVVSAFGEPDWKSKVTYAIRLATCLYSEQLLDRDHYLEWIISGLENSPQSRIPMWILIGQIYWNDLLQSRKCGRRLVFALLKHLNTIENDPDRDILIQLSSQLSTLVIYLLKTNPESFVCPPAWQRLGETLRLVLPTEDAAAQAAYNTVKLRNIRLLVANTTSPPSGRQYLVQLLDSTLQGKCDPGLSARCWASADDKAGILRTAVEWATSLHRPGLAKVYVVAGLIKSWGAHRINATSTILDALGDIPLGDQMRKRLIIRLVGELVRSGHFSVAQYMQWLIGRGGLHGAEEIDPVEGPCPSRLLVELPIHCLLEEQKAQRGSLLRRAGHYSVGDEANDISSALQYVDSSLGLATYLNGSGPFRRPLSLKKLSRKVRNSSWAVQSAIGAHLYDVITSLPPHRPDFVMTLSMFSSVRTMMETVEDYSMLSGILRACSSGPDVDTLAACVDTIDAQLDVFMAIGTAETLFDIFIERLKAMSRDQGIVVRSLLASLASLAARLPQREDLAKQLSQELAQNDRSNAIDACSPVSDSMATQAQTAEGEVSEQIDKLLASGNVIDHPTMNRLFRYVIIKLESGWGKLDDSRRVFSSLLSRLRMLDALHFDKLMADWISHIRTLKERPPLPELFPLLVSFGCLSMSTILHTANAGSVALDITPDTVTPKTATYLQELLQLIIMKLPATALLDAEETYRFQIYQQRAKFEHAKGLLALIRNSLVEYSALQIPGRTAMLPLDDVACQNCLLETMRFMVVADSAIVAEVLNMSTLPPGATSLAHRIVTRLLLPEADSDHHPSFDHILSLADELTMPFCQLKLNLDLSVNLPSISAIEGETPSRFEAFAKAMDKAIESQNIIWTRMLPCLSDDITQSLNTEAHTRFLDLMPSSKSESLASDTTDENRIRLAENLLGVIEAIISGQPPSRSASLTNNLVDKLSDMWEIVTSRDEDRAMAKKEVLGHWLPTLLRFITLHSICSEPAHIATAGPGSSAKTAATPNHEVRARIILLLCGLLLEMETLPKELAGSLAQQIFDIAILLVDALPDDLRTQCAKSILFLPGTTASAGTTSDPRLYYLFSTPRPTSAENLKLVHRDKSSVPYTAAARGMGAMYGIGPTLNERLSPFVLRRWEILSEPTPNVGENDTSLSLRLFEAIKIQ
Length1469
PositionKinase
OrganismMetarhizium anisopliae BRIP 53293
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
Aromaticity0.06
Grand average of hydropathy-0.136
Instability index44.92
Isoelectric point7.17
Molecular weight162415.84
Publications
PubMed=25102932

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP03226
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.78|      16|      47|    1308|    1324|       1
---------------------------------------------------------------------------
 1308- 1324 (24.83/24.30)	ATPNhEVR...ARIILLLCG
 1354- 1372 (23.95/16.06)	ALPD.DLRtqcAKSILFLPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     189.67|      45|      47|     430|     475|       2
---------------------------------------------------------------------------
  428-  469 (67.30/39.17)	...IYLLKTNPESFVC...........PPA.WQRLGETL..RLVLPTEDAAAQAAYNTV
  471-  495 (22.21/ 8.82)	LRNIRLLVANTTS..............PPSgRQYLVQLL....................
 1027- 1061 (48.23/25.74)	.....LLALIRNSLVE...........YSA.LQIPGRT....AMLPLDDVACQ...NCL
 1062- 1116 (51.93/25.53)	LETMRFMVVADSA...ivaevlnmstlPPG.ATSLAHRIvtRLLLPEADSDHHPSFDHI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.44|      26|      41|     229|     255|       3
---------------------------------------------------------------------------
  229-  255 (40.43/34.14)	TKREIWLKDLANpAISLRRLSRTIPHG
  272-  297 (45.01/31.94)	TERAVWLAKCVG.ANEIRAFKRKGASG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.11|      16|      41|     936|     951|       4
---------------------------------------------------------------------------
  936-  951 (28.49/16.76)	TLKERPPLPELFPLLV
  980-  995 (26.62/15.12)	TPKTATYLQELLQLII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.81|      19|      42|      29|      50|       5
---------------------------------------------------------------------------
   29-   50 (31.30/25.43)	PISATESPQTltpSRMMPLPDP
   74-   92 (36.51/20.74)	PMPRRRLPQT...SQAIPSTRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.53|      35|      49|     541|     582|       6
---------------------------------------------------------------------------
  541-  582 (48.61/41.36)	YVVAGLIKsW..GAHRINATSTILDALGDIPlgdqmrKRLIIRL
  592-  628 (59.92/32.80)	FSVAQYMQ.WliGRGGLHGAEEIDPVEGPCP......SRLLVEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.56|      30|      99|    1162|    1192|      16
---------------------------------------------------------------------------
 1162- 1192 (48.22/33.84)	DKAIESQNIIwTRMLPCLSDDIT.QSLNTE.AH
 1263- 1294 (46.34/26.53)	DRAMAKKEVL.GHWLPTLLRFITlHSICSEpAH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.64|      18|     513|     820|     837|      17
---------------------------------------------------------------------------
  820-  837 (30.53/17.54)	LPQREDLAKQLSQELAQN
 1326- 1343 (30.10/17.19)	LLEMETLPKELAGSLAQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03226 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MSGRHVSTPRRQGSKLRLELSNELISAGPISATESPQTLTPSRMMPLPDPMETDNMSPALSRVSQQDSDNPPMPMPRRRLPQTSQAIPSTRPAAPTPASTKKDARPKPYTVEVPTAAPRYVNTNKHETIGRDPF
1
134










Molecular Recognition Features






MoRF SequenceStartStop




1) KLRLELS
15
21