Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDSTADLHPPDDGGGRYFIWHEWIQANSPMTAENVFEYFACSQFYDKQSNNQVLRMQTMHTGVARENEAEELKRFVGIEFAVVHADTTANFFIIHKRERTSPEHTTPLAVYFIENNRVFQAPDIYTLVSMRLAASIQGLQKTLDSVRSRRPEYTPRTGYVWPVSMSDFAEPNDIAQSKPATLKDGAETQPNSRGASVEPGVRAPPRQGAPQRQQNNSLMLNAMRATALHSQLQNHVGSSAFTNMANVLRNAEGHDSQQANSQPKGQQTSSQQAESSRGPATPANPAPATPKPPTKEPGPPGGGKKKKKRTATMNSPPPPTTSTQP |
Length | 325 |
Position | Head |
Organism | Cylindrobasidium torrendii FP15055 ss-10 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Physalacriaceae> Cylindrobasidium. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.820 |
Instability index | 56.91 |
Isoelectric point | 9.12 |
Molecular weight | 35733.34 |
Publications | PubMed=25683379 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03208 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 157.57| 45| 91| 177| 221| 1 --------------------------------------------------------------------------- 177- 221 (77.44/28.58) SKPATLKDGAETQPNSRGASVEPGVRAPPRQGAPQRQQNNSLMLN 270- 314 (80.13/29.78) SQQAESSRGPATPANPAPATPKPPTKEPGPPGGGKKKKKRTATMN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ATPKPPTKEPGPPGGGKKKKKRTATMNSPPPPTTSTQP 2) RYFIW | 288 16 | 325 20 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab