<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03191

Description Uncharacterized protein
SequenceMEEVQHPLHDHQQWMGLMQPQSQHNQQHQSQQHIMAAFQSQSNQLQQELGMEQKPSVQQNFQTSAGMFLQQNNIDEQMQYTQAQCGLQEVPFSTTMHITTQTDHPGQCYLQDEIYDMVRNLKDQHFTELYHLYNKISRKQEYVDSQMPSQMPIEQYGKMKKFKEMLERIL
Length170
PositionTail
OrganismOryza barthii
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza.
Aromaticity0.08
Grand average of hydropathy-1.033
Instability index81.68
Isoelectric point5.60
Molecular weight20276.54
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03191
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.79|      19|      21|      69|      89|       1
---------------------------------------------------------------------------
   69-   88 (31.05/14.57)	LQQNNIDEQMQYtQAQCGLQ
   93-  111 (32.74/12.25)	STTMHITTQTDH.PGQCYLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.03|      15|      15|      11|      25|       2
---------------------------------------------------------------------------
   11-   25 (32.61/14.77)	HQQWMGLMQP.QSQHN
   28-   43 (23.42/ 8.83)	HQSQQHIMAAfQSQSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.41|      12|      21|     133|     144|       3
---------------------------------------------------------------------------
  133-  144 (20.50/14.75)	YNKISRKQEYVD
  156-  167 (20.91/15.17)	YGKMKKFKEMLE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03191 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MEEVQHPLHDHQQWMGLMQPQSQHNQQHQSQQHIMAAFQSQSNQLQQELGMEQKPSV
1
57










Molecular Recognition Features






MoRF SequenceStartStop




NANANA