<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03190
| Description |
Uncharacterized protein |
| Sequence | MDITYKALQETDIGRHVNGLRKHPSGEVRLLVKQLIRKWKEIVDDWVRLHNSSGDASNSIITDGNSPEKIQGKNQQSSQVSEFKYSPSPSRHNNSSSERVSNGIASIAATKHRASPAPAHHNARQINNTHHSTTSSSAPARMVKEQKDSHLDLERLDSARKRLQENYQEAQNAKKQRTIQVMDINEIPKPKNRNAFIRKGNGGGFPARHR |
| Length | 210 |
| Position | Unknown |
| Organism | Oryza barthii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.096 |
| Instability index | 54.51 |
| Isoelectric point | 10.24 |
| Molecular weight | 23633.03 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03190
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.97| 17| 18| 102| 119| 1
---------------------------------------------------------------------------
102- 119 (26.49/18.27) NGiASIAATKH..RASPAPA
122- 140 (26.48/13.70) NA.RQINNTHHstTSSSAPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.81| 19| 28| 144| 162| 2
---------------------------------------------------------------------------
144- 162 (29.93/19.02) KEQKDSH.LDLERLDSARKR
174- 193 (27.87/17.29) KKQRTIQvMDINEIPKPKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.26| 16| 18| 66| 81| 3
---------------------------------------------------------------------------
66- 81 (27.68/17.20) SPEKIQGKNQQSSQVS
86- 101 (28.58/17.99) SPSPSRHNNSSSERVS
---------------------------------------------------------------------------
|