<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03188
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEPEAMPAPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPAPAPAPAPATVPPAAPVPSTVVPPVAAPSSSLPPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKYALPLQSSISLMKLFVFFAVMFCLASCFPSMRTYFCFCFLDYEDPLPVIQERRLRLSMCFCRRAELFLFGRNRYLLKKKN |
| Length | 280 |
| Position | Middle |
| Organism | Oryza barthii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.233 |
| Instability index | 65.06 |
| Isoelectric point | 9.51 |
| Molecular weight | 32179.32 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03188
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.48| 18| 20| 122| 139| 1
---------------------------------------------------------------------------
122- 139 (36.50/17.07) PEPTPAPAPAPAP.ATVPP
142- 160 (29.98/12.76) PVPSTVVPPVAAPsSSLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.40| 22| 27| 16| 42| 2
---------------------------------------------------------------------------
16- 37 (39.90/26.28) QRFLLELEFIQCLANPTYIHYL
46- 67 (41.50/17.26) EAFIGYLKYLKYWQRPEYIKYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.59| 18| 26| 74| 91| 4
---------------------------------------------------------------------------
69- 89 (26.39/12.85) YP........hclFFLELLQNANFRNAMA
90- 118 (27.19/13.42) HPaskevahrqqyFFWKNYRNNRLKHILP
---------------------------------------------------------------------------
|