<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03183
Description |
Uncharacterized protein |
Sequence | MEATVDELSEAYQEFVAAAAAVVEARGQSGGEKNAATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGASSSSAALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGSASAAGPGGGGGAAAAASGAAGQHGHGGVDTRFPEDGAQ |
Length | 159 |
Position | Tail |
Organism | Oryza barthii |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.111 |
Instability index | 47.59 |
Isoelectric point | 4.77 |
Molecular weight | 16045.48 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03183
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 113| 18| 30| 1
---------------------------------------------------------------------------
18- 30 (21.58/ 9.75) AAAAVVEARGQSG
36- 48 (19.77/ 8.45) ATDAALEAFKQRW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.47| 13| 35| 80| 92| 2
---------------------------------------------------------------------------
80- 92 (23.47/ 8.69) GASSSSAALAAPG
118- 128 (22.06/ 7.76) GAGSASA..AGPG
130- 142 (21.94/ 7.68) GGGAAAAASGAAG
---------------------------------------------------------------------------
|