<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03147
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYPHCLFFLELLQNANFRNAMAHPASKEIAHRQQYFFWKNYRNNRLKHILPRPPPEPTPMPATAPAAVPPAAPVPSTVVPPAAAPPSSLPPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKKDG |
| Length | 200 |
| Position | Middle |
| Organism | Oryza barthii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.584 |
| Instability index | 61.80 |
| Isoelectric point | 9.46 |
| Molecular weight | 22531.63 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03147
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.52| 22| 27| 115| 139| 1
---------------------------------------------------------------------------
115- 136 (44.54/16.47) ILPR...PPPEPTPMPATAPAAVPP
144- 168 (36.99/ 8.34) VVPPaaaPPSSLPPMSAAGASAMSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.20| 19| 27| 20| 38| 2
---------------------------------------------------------------------------
20- 38 (35.55/20.33) FLLELEFIQCLANPTYIHY
50- 68 (37.65/21.87) FIGYLKYLKYWQRPEYIKY
---------------------------------------------------------------------------
|