<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03129
| Description |
Uncharacterized protein |
| Sequence | MSGFNRMGSDGNFGKGPRELTGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLHNVVGDTEIRKGEGMELDQLFQDAYLREKTSYIQPFDMETLGQAFQLRETAPIDLPSAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKKRKQEGLEDLASGHNPKKVTLIF |
| Length | 218 |
| Position | Head |
| Organism | Oryza barthii |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.392 |
| Instability index | 27.05 |
| Isoelectric point | 9.68 |
| Molecular weight | 25200.36 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03129
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.58| 14| 15| 132| 146| 1
---------------------------------------------------------------------------
132- 146 (22.97/11.18) KKHKrHKEKDKDKYK
149- 162 (26.62/ 9.89) KKHK.HRHKDRSKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.27| 16| 18| 170| 187| 2
---------------------------------------------------------------------------
170- 185 (28.19/14.62) KEKEKKKDKSAHHD..SG
191- 208 (24.08/ 6.27) KHHEKKRKQEGLEDlaSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.40| 14| 18| 74| 91| 3
---------------------------------------------------------------------------
74- 91 (20.94/26.05) LFQDAYLREKTsyiqPFD
95- 108 (25.46/17.84) LGQAFQLRETA....PID
---------------------------------------------------------------------------
|