<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03097
| Description |
Uncharacterized protein |
| Sequence | MESESAKFGGPRELGGARDLITQYKLLPHHEFFCKRSLPESLSDAHYLHNVVGDTDIRKGEGMQLDQLIPNASHNRDTNARIQPFVLDELKEAFELNDTSPVELPPAEKGALTIASKSKSESKDRDRKHKKHKDRNKDKDREHKKHKHRHKDRSKDKDKDKDRERKKEKSGHHDKKRKHNGNEDLDDAQRHKKSKHKSSKVDER |
| Length | 204 |
| Position | Head |
| Organism | Brassica oleracea var. oleracea |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.680 |
| Instability index | 38.95 |
| Isoelectric point | 9.53 |
| Molecular weight | 23764.20 |
| Publications | PubMed=24916971
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03097
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.17| 21| 21| 132| 152| 1
---------------------------------------------------------------------------
132- 152 (41.81/14.46) HKDRNKDKDREHKKHKHRHKD
154- 174 (38.35/12.76) SKDKDKDKDRERKKEKSGHHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.72| 15| 21| 65| 84| 2
---------------------------------------------------------------------------
49- 68 (14.16/14.75) HNvvGDTDIRKgEGmqLDQL
74- 90 (23.56/ 9.34) HN..RDTNARI.QPfvLDEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.19| 12| 15| 175| 187| 3
---------------------------------------------------------------------------
175- 187 (17.20/14.66) KKRKHNGNEdLDD
192- 203 (19.99/11.14) KKSKHKSSK.VDE
---------------------------------------------------------------------------
|