<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03092
Description |
Uncharacterized protein |
Sequence | MGVKLSPAVSKKQRTIHCQCLDLANIRDPCSKKGFQMGIALPQFLLDIDGASGGILLLWIVGVCILLPLVITVIYLSRSSKYTGNYVMHQTLSAYIIFVGPKQSYGRFYQGSCELSLDPKNMKQEQAKFWKQHPAIVKMAVLPRTAQGHGWLRPAVGVVELSQCIVLEILGQYSMVNIELFNIVEEVKKVSKAFVVLPKNVNAENAQSWDRVKRRSILLYRNYLQKG |
Length | 227 |
Position | Head |
Organism | Brassica oleracea var. oleracea |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.097 |
Instability index | 56.10 |
Isoelectric point | 9.63 |
Molecular weight | 25510.88 |
Publications | PubMed=24916971
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP03092
No repeats found
No repeats found
|