<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03074
Description |
Uncharacterized protein |
Sequence | MDNILDSLNKAYEKFVIASAEVLESKESAGGIKASLTDAALENFKEKWELFRVACDQAEEFVESVKQRIGSECLVDEATGLTTGGGSNSGQSVGAATSLPPISAVRLEQMSRAVRWLVLELQRGSGGAAAGSVHSSSSAGFDPRYMDSNEPMLLLSSRIGQIGDLGLDLLWRFLHIVVSLFHIVSGIFEAIQSYAISLGLIQKYSSIDIEKLRCLAVVLDIEVARDVAKVVELLQWLKTIGVKQVGLFDSQGLLKKSKDMILEMVPGSTLLQETGEKDISPDRKEGIAIEFISSSDNKEAVVKAANILLQRHLKTSHPEKDEGDNVFTESHLNEALRVVGLCLFSHLEL |
Length | 349 |
Position | Tail |
Organism | Brassica oleracea var. oleracea |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.039 |
Instability index | 52.40 |
Isoelectric point | 5.05 |
Molecular weight | 37972.99 |
Publications | PubMed=24916971
|
Function
Annotated function |
|
GO - Cellular Component | dehydrodolichyl diphosphate synthase complex GO:1904423 IEA:InterPro
endoplasmic reticulum GO:0005783 IEA:UniProtKB-KW
integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | transferase activity, transferring alkyl or aryl (other than methyl) groups GO:0016765 IEA:InterPro
|
GO - Biological Process | dolichol biosynthetic process GO:0019408 IEA:InterPro
protein glycosylation GO:0006486 IEA:UniProtKB-UniPathway
|
Interaction
Repeat regions
Repeats |
>MDP03074
No repeats found
|