<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03064
| Description |
Uncharacterized protein |
| Sequence | MAANFWESSQYKQLLDQEEVDVVQPLDKERGISVEDFKLIKFHMSNHIMKLAQHIKVRQRVVATAITYMRRVYTKKSMVEFEPRLVAIACLYLASKAEESIVQARNLVFYSKRLYPDEYKYELKDILGMEMRVLEALDYYLVVFHPYRSLSEYVPTSLYCLSEANVIMNTFSLIFCEAGIVNDTYKMDLILVHPPYRIALACIYIASVQREKDITAWLQDLNEDMNLVKNIAMEILDFYENYRTITDEKVSSAFSKLALKP |
| Length | 261 |
| Position | Kinase |
| Organism | Brassica oleracea var. oleracea |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.052 |
| Instability index | 41.06 |
| Isoelectric point | 5.82 |
| Molecular weight | 30554.21 |
| Publications | PubMed=24916971
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03064
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.39| 22| 109| 83| 104| 1
---------------------------------------------------------------------------
83- 104 (37.26/26.01) PRLVAIACLYLASKAEESIVQA
195- 216 (39.14/27.64) PYRIALACIYIASVQREKDITA
---------------------------------------------------------------------------
|